CART_RAT P49192
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P49192
Recommended name：Cocaine- and amphetamine-regulated transcript protein
EC number：
Alternative names：
Cleaved into：
GeneID：
Gene names (primary )：Cartpt
Gene names (synonym )：Cart
Gene names (ORF )：
Length：129
Mass：14,140
Sequence：MESSRLRLLPVLGAALLLLLPLLGAGAQEDAELQPRALDIYSAVDDASHEKELPRRQLRAPGAVLQIEALQEVLKKLKSKRIPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL
Tissue specificity：Neuroendocrine tissues. Predominantly expressed in the hypothalamus, pituitary, and longitudinal muscle-myenteric plexus. Abundant expression is also seen in the midbrain/thalamus and eye. A lower level expression is seen in the other brain regions and adrenal.
Induction：
Developmental stage：By cocaine and amphetamine.
Protein families：