MARCS_RAT   P30009


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P30009

Recommended name:Myristoylated alanine-rich C-kinase substrate

EC number:

Alternative names:Protein kinase C substrate 80 kDa protein

Cleaved into:

GeneID:

Gene names  (primary ):Marcks

Gene names  (synonym ):Macs

Gene names  (ORF ):

Length:309

Mass:29,795

Sequence:MGAQFSKTAAKGEAAAERPGEAAVASSPSKANGQENGHVKVNGDASPAAAEPGAKEELQANGSAPAADKEEPASGGAATPAAADKDEAAAAPEPGAATADKEAAEAEPAEPGSPSAETEGASASSTSSPKAEDGAAPSPSSETPKKKKKRFSFKKSFKLSGFSFKKSKKEAGEGAEAEGATADGAKDEAAAAAGGDAAAAPGEQAGGAGAEGAEGGESREAEAAEPEQPEQPEQPAAEEPRAEEPSEAVGEKAEEPAPGATADDAPSAAGPEQEAPAATDEPAASAAPSASPEPQPECSPEAPPAPVAE

Tissue specificity:Highest levels found in spleen and brain. Intermediate levels seen in thymus, ovary, lung and heart. Very low levels seen in kidney, skeletal muscle and liver. 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp