FCERA_RAT P12371
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P12371
Recommended name：High affinity immunoglobulin epsilon receptor subunit alpha
EC number：
Alternative names：
Cleaved into：
GeneID：
Gene names (primary )：Fcer1a
Gene names (synonym )：Fce1a
Gene names (ORF )：
Length：245
Mass：27,793
Sequence：MDTGGSARLCLALVLISLGVMLTATQKSVVSLDPPWIRILTGDKVTLICNGNNSSQMNSTKWIHNDSISNVKSSHWVIVSATIQDSGKYICQKQGFYKSKPVYLNVMQEWLLLQSSADVVLDNGSFDIRCRSWKKWKVHKVIYYKDDIAFKYSYDSNNISIRKATFNDSGSYHCTGYLNKVECKSDKFSIAVVKDYTIEYRWLQLIFPSLAVILFAVDTGLWFSTHKQFESILKIQKTGKGKKKG
Tissue specificity：Expressed in leukocytes and pinealocytes at night (at protein level). 2 s
Induction：
Developmental stage：Exhibits night/day variations with a 15-fold increased expression at night in the pineal gland. Up-regulation is due to a large degree to the release of norepinephrine from nerve terminals in the pineal gland and cAMP signaling pathway (at protein level). 2 s
Protein families：