NPY_RAT P07808
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P07808
Recommended name:Pro-neuropeptide Y
EC number:
Alternative names:
Cleaved into:
GeneID:24604
Gene names (primary ):Npy
Gene names (synonym ):
Gene names (ORF ):
Length:98
Mass:11,033
Sequence:MMLGNKRMGLCGLTLALSLLVCLGILAEGYPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRYGKRSSPETLISDLLMRESTENAPRTRLEDPSMW
Tissue specificity:One of the most abundant peptides in the nervous system. Also found in some chromaffin cells of the adrenal medulla.
Induction:
Developmental stage:
Protein families: