PA1B3_RAT   O35263


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O35263

Recommended name:Platelet-activating factor acetylhydrolase IB subunit alpha1 Curated

EC number:EC:3.1.1.47

Alternative names:PAF acetylhydrolase 29 kDa subunit (PAF-AH 29 kDa subunit) PAF-AH subunit gamma (PAFAH subunit gamma) Platelet-activating factor acetylhydrolase alpha 1 subunit (PAF-AH alpha 1)

Cleaved into:

GeneID:114113

Gene names  (primary ):Pafah1b3

Gene names  (synonym ):Pafahg

Gene names  (ORF ):

Length:232

Mass:25,863

Sequence:MSGEGENPASKPTPVQDVQGDGRWMSLHHRFVADSKDKEPEVVFIGDSLVQLMHQCEIWRELFSPLHALNFGIGGDSTQHVLWRLENGELEHIRPKIVVVWVGTNNHSHTAEQVTGGIKAIVQLVNKLQPQARVVVLGLLPRGQHPNPLREKNRQVNELVRAALAGYPRAHFLDADPGFVHSDGTISHHDMYDYLHLSRLGYTPVCRALHSLLLRLLAQDQGQGIPLPETAP

Tissue specificity:Expressed in brain, spleen, lung, liver, kidney and testis. Not expressed in heart and skeletal muscle. Expressed in fetal brain as heterodimer (PubMed:9660828). Not expressed in adult tissues (PubMed:9660828). Expressed exclusively in granule cells (PubMed:9660828). 1

Induction:

Developmental stage:During the embryonic stages, high expressed in the brain, spinal cord, sensory ganglia (dorsal root and trigeminal ganglia), and thymus. In brain found throughout the ventricular and marginal zones. Expressed mainly in neural tissues. 1

Protein families:


   💬 WhatsApp