YLAT1_RAT   Q9R0S5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9R0S5

Recommended name:Y+L amino acid transporter 1 Curated

EC number:

Alternative names:

Cleaved into:

GeneID:83509

Gene names  (primary ):Slc7a7

Gene names  (synonym ):

Gene names  (ORF ):

Length:512

Mass:55,641

Sequence:MVASTKYEVAAQNEADEADGSAQGDGAGPAAEQVKLKKEISLLNGVCLIVGNMIGSGIFVSPKGVLMYSASFGLSLVIWAVGGIFSVFGALCYAELGTTIKKSGASYAYILEAFGGFLAFIRLWTSLLIIEPTSQAVIAITFANYMVQPLFPSCGAPYAAGRLLAAACICLLTFINCAYVKWGTLVQDIFTYAKVLALIAVIIAGIVRLGQGATTNFEDSFEGSSFAMGDIALALYSALFSYSGWDTLNYVTEEIRNPERNLPLSIGISMPIVTIIYLLTNVAYYSVLDIKDILASDAVAVTFADQIFGIFNWTIPLAVALSCFGGLNASIVAASRLLFVGSREGHLPDAICMIHVERFTPVPSLLFNGILALVYLCVEDIFQLINYYSFSYWFFVGLSIVGQLYLRWKEPDRPRPLKLSLFFPIVFCLCTIFLVAVPLYSDTINSLIGIGIALSGLPFYFLIIRVPEHKRPLCLRRIVASTTRYLQIICMSVAAEMDLEDGELPKQGPKSK

Tissue specificity:Expressed in kidney cortex and intestine. 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp