NT8F3_RAT   Q9QXS4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9QXS4

Recommended name:N-acetyltransferase family 8 member 3 Imported

EC number:EC:2.3.1.48

Alternative names:Camello-like protein 3 Imported N-acetyltransferase CML3 Imported

Cleaved into:

GeneID:113892

Gene names  (primary ):Nat8f3

Gene names  (synonym ):Cml3 Imported

Gene names  (ORF ):

Length:228

Mass:26,038

Sequence:MAPYHIRKYQDSDHRSVVNLFCRGTEEHISASFRYMLLLPGTLLILLGVPLTLFLASGSWLLVLLSTLTLLVSLWLLAKYPWEKYTAMCLHSDMADIPRTYLSSHYSCFWVAESRGQMVGIIAVLPVKDPLLQRKQLQLRHLSVSLEHRREGIGRAMVRTALQFAEMQGFSEVVLVTSMLQYAALALYQSMGFQKTGEFFYTFVSRLRNSPMICLKYCLTSALNDLKT

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp