CDK7_RAT P51952
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P51952
Recommended name：Cyclin-dependent kinase 7
EC number：EC:2.7.11.22
Alternative names：39 protein kinase (P39 Mo15) CDK-activating kinase 1 Cell division protein kinase 7 TFIIH basal transcription factor complex kinase subunit
Cleaved into：
GeneID：
Gene names (primary )：Cdk7
Gene names (synonym )：Cak, Cak1, Mo15
Gene names (ORF )：
Length：329
Mass：37,141
Sequence：ANRNEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTALREIKLLQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNWAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLQHIFIAAGDDLLELIQGLFLFNPCTRITASQALRTKYFSNRPGPTPGCQLPRPNCPVEALKEQSNPAMATKRKRAEALEQ
Tissue specificity：
Induction：
Developmental stage：
Protein families：