S26A1_RAT P45380
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P45380
Recommended name：Sulfate anion transporter 1
EC number：
Alternative names：Canalicular sulfate transporter Solute carrier family 26 member 1 Sulfate/carbonate antiporter
Cleaved into：
GeneID：
Gene names (primary )：Slc26a1
Gene names (synonym )：Sat1
Gene names (ORF )：
Length：703
Mass：75,447
Sequence：MDASPEPPQKGGTLVLVRRQPPVSQGLLETLKARLKKSCTCSMPCAQALVQGLFPVIRWLPQYRLKEYLAGDVMSGLVIGIILVPQAIAYSLLAGLQPIYSLYTSFFANLIYFLMGTSRHVNVGIFSLLCLMVGQVVDRELQLAGFDPSQDSLGPGNNDSTLNNTATLTVGLQDCGRDCHAIRIATALTLMAGLYQVLMGILRLGFVSTYLSQPLLDGFAMGASVTILTSQAKHLLGVRIPRHQGLGMVIHTWLSLLQNVGQANLCDVVTSAVCLAVLLTAKELSDRYRHYLKVPVPTELLVIVVATIASHFGQLHTRFGSSVAGNIPTGFVAPQIPDPKIMWSVALDAMSLALVGSAFSISLAEMFARSHGYSVSANQELLAVGCCNVLPAFFHCFATSAALSKTLVKIATGCQTQLSSVVSAAVVLLVLLVLAPLFHDLQRCVLACIIVVSLRGALRKVKDLPQLWRLSPADALVWVATAATCVLVSIEAGLLAGVFFSLLSLAGRTQRPRAALLARIGDSTFYEDAAEFEGLLPPPEVRVFRFTGPLYYANKDFFLRSLYSLTGLDAGYSATRKDRGTEVGVSNRSLVDRKDLGSVSSGDGLVVPLAFGFHTVVIDCAPLLFLDVAGMATLKDLRKNYRALDITLLLACCSPSVRDTLRKGGFLGEDQGTAEELLFPSVHSAVETACARREELMAADSAL
Tissue specificity：Expressed in kidney cortex and medulla, ileum and colon (at protein level) (PubMed:27210743, PubMed:9689008). Expressed in liver and kidney (PubMed:8300633). Less abundant in muscle and brain (PubMed:8300633). Expressed in the hepatocytes and endothelial cells (PubMed:16357056). 4 s
Induction：
Developmental stage：
Protein families：