CBS_RAT P32232
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P32232
Recommended name：Cystathionine beta-synthase Curated
EC number：EC:4.2.1.22
Alternative names：Beta-thionase Hemoprotein H-450 Serine sulfhydrase
Cleaved into：
GeneID：
Gene names (primary )：Cbs
Gene names (synonym )：
Gene names (ORF )：
Length：561
Mass：61,455
Sequence：MPSGTSQCEDGSAGCPQDLEVQPEKGQLEKGASGDKERVWISPDTPSRCTWQLGRPMADSPHYHTVPTKSPKILPDILRKIGNTPMVRINRISKNAGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERAGTLKPGDTIIEPTSGNTGIGLALAAAVKGYRCIIVMPEKMSMEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDDTAEEILQQCDGKVDMLVASAGTGGTITGIARKLKEKCPGCKIIGVDPEGSILAEPEELNQTEQTAYEVEGIGYDFIPTVLDRAVVDRWFKSNDDDSFAFARMLISQEGLLCGGSSGSAMAVAVKAAQELKEGQRCVVILPDSVRNYMSKFLSDKWMLQKGFMKEELSVKRPWWWHLRVQELSLSAPLTVLPTVTCEHTIAILREKGFDQAPVVNESGAILGMVTLGNMLSSLLAGKVRPSDEVCKVLYKQFKPIHLTDTLGMLSHILEMDHFALVVHEQIQSRDQAWSGVVGGPTDRNNGVSSKQLMVFGVVTAIDLLNFVAAREQTRK
Tissue specificity：Expressed in liver, kidney and brain. Highly expressed in the hippocamus and cerebellum. 2 s
Induction：
Developmental stage：
Protein families：