SSR2_RAT P30680
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P30680
Recommended name：Somatostatin receptor type 2
EC number：
Alternative names：SRIF-1
Cleaved into：
GeneID：
Gene names (primary )：Sstr2
Gene names (synonym )：
Gene names (ORF )：
Length：369
Mass：41,200
Sequence：MELTSEQFNGSQVWIPSPFDLNGSLGPSNGSNQTEPYYDMTSNAVLTFIYFVVCVVGLCGNTLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMTVDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMINVAVWGVSLLVILPIMIYAGLRSNQWGRSSCTINWPGESGAWYTGFIIYAFILGFLVPLTIICLCYLFIIIKVKSSGIRVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSVAISPTPALKGMFDFVVILTYANSCANPILYAFLSDNFKKSFQNVLCLVKVSGAEDGERSDSKQDKSRLNETTETQRTLLNGDLQTSI
Tissue specificity：Cortex, hippocampus, pituitary gland, colon, kidney, and adrenal gland. In the developing nervous system, expressed from E12 when it is restricted to postmitotic neuronal populations leaving the ventricular zone. From E12 on, expressed in migrating neuronal populations in numerous developing regions including the cerebral cortex, hippocampus and ganglionic eminences. Also detected in the deep part of the external granular layer of the cerebellum, the rostral migratory stream and a subset of axons and neurons. Expressed in the medial forebrain bundle, rostral migratory stream and cerebellum during development but not in adulthood. 3 s
Induction：
Developmental stage：
Protein families：