PTGES_RAT   Q9JHF3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9JHF3

Recommended name:Prostaglandin E synthase

EC number:EC:5.3.99.3

Alternative names:mPGES-1

Cleaved into:

GeneID:59103

Gene names  (primary ):Ptges

Gene names  (synonym ):Pges 1 Publication, Pig12 1 Publication

Gene names  (ORF ):

Length:153

Mass:17,273

Sequence:MTSLGLVMENSQVLPAFLLCSTLLVIKMYAVAVITGQVRLRKKAFANPEDALKRGGLQYCRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPLIAWIHFLVVLTGRVVHTVAYLGKMNPRIRSGAYVLAQFACFSMALQILWEVAHHL

Tissue specificity:Up-regulated after treatment with LPS or in a rat model of adjuvant-induced arthritis (PubMed:10869354, PubMed:11067848). Down-regulated by the anti-inflammatory glucocorticoid dexamethasone (PubMed:10869354). 2 s

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp