ABHD5_RAT Q6QA69
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q6QA69
Recommended name：1-acylglycerol-3-phosphate O-acyltransferase ABHD5 Curated
EC number：EC:2.3.1.51
Alternative names：Abhydrolase domain-containing protein 5 Lipid droplet-binding protein CGI-58 (Protein CGI-58)
Cleaved into：
GeneID：316122
Gene names (primary )：Abhd5
Gene names (synonym )：
Gene names (ORF )：
Length：351
Mass：39,104
Sequence：MKAMAAEEEVDSADAGGGSGWLTGWLPTWCPTSTSHLKEAEEKMLKCVPCTYKKEPVRISNGNSIWTLMFSHNMSSKTPLVLLHGFGGGLGLWALNFEDLSTDRPVYAFDLLGFGRSSRPRFDSDAEEVENQFVESIEEWRCALRLDKMILLGHNLGGFLAAAYSLKYPSRVSHLILVEPWGFPERPDLADQERPIPVWIRALGAALTPFNPLAGLRIAGPFGLSLVQRLRPDFKRKYSSMFEDDTVTEYIYHCNVQTPSGETAFKNMTIPYGWAKRPMLQRIGGLHPDIPVSVIFGARSCIDGNSGTSIQSLRPKSYVKTIAILGAGHYVYADQPEEFNQKVKEICHTVD
Tissue specificity：Increased in the early stage of adipocyte differentiation. 1
Induction：
Developmental stage：
Protein families：peptidase S33 family