CD14_RAT Q63691
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q63691
Recommended name：Monocyte differentiation antigen CD14
EC number：
Alternative names：CD14
Cleaved into：
GeneID：60350
Gene names (primary )：Cd14
Gene names (synonym )：
Gene names (ORF )：
Length：372
Mass：40,054
Sequence：MKLMLGLLLLPLTLVHASPATPEPCELDQDEESVRCYCNFSDPQPNWSSAFLCAGAEDVEFYGGGRSLEYLLKRVDTEANLGQYTDIIRSLPLKRLTVRSARVPTQILFGTLRVLGYSGLRELTLENLEVTGTALSPLLDATGPDLNTLSLRNVSWATTDTWLAELQQWLKPGLKVLSIAQAHSLNFSCKQVGVFPALATLDLSDNPELGEKGLISALCPHKFPTLQVLALRNAGMETTSGVCSALAAARVPLQALDLSHNSLRDTAGTPSCDWPSQLNSLNLSFTGLEHVPKGLPAKLSVLDLSYNRLDRKPRPEELPEVGSLSLTGNPFLHSESQSEAYNSGVVIATALSPGSAGLSGTLALLLGHRLFV
Tissue specificity：Detected in macrophages and peripheral blood monocytes. 1
Induction：
Developmental stage：Up-regulated in Kuppfer cells exposed to bacterial lipopolysaccharide (LPS). 1
Protein families：