SEP12_RAT Q4V8G5
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q4V8G5
Recommended name：Septin-12
EC number：
Alternative names：
Cleaved into：
GeneID：363542
Gene names (primary )：Septin12 By Similarity
Gene names (synonym )：Sept12 Imported
Gene names (ORF )：
Length：356
Mass：40,799
Sequence：MDERRTPSPCSSRPSSPRTPPCEMFGPVGIEAVLDQLRIKAMKTGFEFNIMVVGQSGLGKSTMVNTLFKSKVWQSPAPNLDVPMPQTLELHSVTHVIEEKGLKLKLTVTDTPGFGDQINNDKCWDPILSYINQQYEQYLQEELLITRQRHIPDTRVHCCVYFVPPTGHCLRPLDIEFLRRLCRTVNVVPVIARADSLTIEERDAFRSRIQQNLKNHCIDVYPQQCFDEDINDRLLNSKIREQIPFAVVGADREHIVNGRCVLGRKTKWGIIEVENMAHCEFLLLRDLLIRSHLQDLKDITHNVHYENYRVLRLNESHVLPRGPGWVNLAPASPGQLMAPGPEKVRKRSKDPRDDEC
Tissue specificity：Predominantly expressed in testis and epididymis. Component of the sperm tail annulus (at protein level). 1
Induction：
Developmental stage：In developing testis, expression increases steadily until sexual maturity (approximately 49 days postpartum) where it remains expressed at a relatively constant level. 1
Protein families：