RHBL4_RAT   Q4V8F3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q4V8F3

Recommended name:Rhomboid-related protein 4

EC number:EC:3.4.21.105

Alternative names:RRP4

Cleaved into:

GeneID:316557

Gene names  (primary ):Rhbdd1

Gene names  (synonym ):Rhbdl4

Gene names  (ORF ):

Length:316

Mass:35,879

Sequence:MQRRTRGIDTGLLLLLSQVFHIGINNIPPVTLATLAVNVWFFLNPWKPLYHSCISVEKCYQQNDWQRLLLSPVHHGDDWHLYFNMVSMLWKGVKLEKRLGSRWFAYIIATFSLLTGVVYLLLQFASAELMNQPDFKRNCAVGFSGVLFALKVLSNHYCPGGFVNILGFPVPNRFACWAELAAIHFCTPGTSFAGHLAGILVGLMYTQGPLKKIMDACAGIFISNAGSSGQQYHFNNAGPSGYQNRYTDGRPVNYEATYRNYDIYTAGLSEEEQLERALRASIWDRGNTRNGPIPYGFRLPPEEEMRRQRLHRFDGQ

Tissue specificity:Expressed in intestine, lung, brain, kidney, epididymis and testis. 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp