ATG12_RAT   Q2TBJ5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q2TBJ5

Recommended name:Ubiquitin-like protein ATG12 Curated

EC number:

Alternative names:

Cleaved into:

GeneID:361321

Gene names  (primary ):Atg12

Gene names  (synonym ):Apg12l

Gene names  (ORF ):

Length:141

Mass:15,284

Sequence:MAEDPEAVLQLPAAPAAAAGESLLELSPETAIPEPPSSVAVSPGTEEPPGDTKKKIDILLKAVGDTPIMKTKKWAVERTRTVQALIDFIRKFLRLLASEQLFIYVNQSFAPSPDQEVGTLYECFGSDGKLVLHYCKSQAWG

Tissue specificity:Activated in retinal ganglion cells (RGCs) following optic nerve transection (PubMed:18521932). Induced under starvation conditions, through the action of the Foxo1 and Foxo3 transcription factors (PubMed:19696026, PubMed:24187137). 3 s

Induction:

Developmental stage:

Protein families:ATG12 family


   💬 WhatsApp