PGTB2_RAT Q08603
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q08603
Recommended name：Geranylgeranyl transferase type-2 subunit beta
EC number：EC:2.5.1.60
Alternative names：Geranylgeranyl transferase type II subunit beta (GGTase-II-beta) Rab geranyl-geranyltransferase subunit beta (Rab GG transferase beta; Rab GGTase beta) Rab geranylgeranyltransferase subunit beta Type II protein geranyl-geranyltransferase subunit beta
Cleaved into：
GeneID：25533
Gene names (primary )：Rabggtb
Gene names (synonym )：Ggtb
Gene names (ORF )：
Length：331
Mass：36,856
Sequence：MGTQQKDVTIKSDAPDTLLLEKHADYIASYGSKKDDYEYCMSEYLRMSGVYWGLTVMDLMGQLHRMNKEEILVFIKSCQHECGGVSASIGHDPHLLYTLSAVQILTLYDSIHVINVDKVVAYVQSLQKEDGSFAGDIWGEIDTRFSFCAVATLALLGKLDAINVEKAIEFVLSCMNFDGGFGCRPGSESHAGQIYCCTGFLAITSQLHQVNSDLLGWWLCERQLPSGGLNGRPEKLPDVCYSWWVLASLKIIGRLHWIDREKLRSFILACQDEETGGFADRPGDMVDPFHTLFGIAGLSLLGEEQIKPVSPVFCMPEEVLQRVNVQPELVS
Tissue specificity：Most abundant in the heart, brain, spleen and liver. Less in the lung, muscle, kidney and testis; in these tissues, more abundant than the subunit alpha. 1
Induction：
Developmental stage：
Protein families：