NAR2B_RAT P20974
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P20974
Recommended name:T-cell ecto-ADP-ribosyltransferase 2
EC number:EC:2.4.2.31
Alternative names:ADP-ribosyltransferase C2 and C3 toxin-like 2 (ARTC2) Alloantigen Rt6.2 Mono(ADP-ribosyl)transferase 2B NAD(+) glycohydrolase (EC:3.2.2.5 By Similarity) . EC:3.2.2.5 (UniProtKB | ENZYME | Rhea) By Similarity T-cell NAD(P)(+)--arginine ADP-ribosyltransferase 2 More alternative names
Cleaved into:
GeneID:293152
Gene names (primary ):Art2b
Gene names (synonym ):Rt6-b
Gene names (ORF ):
Length:275
Mass:31,438
Sequence:MPSNICKFFLTWWLIQQVTGLTGPLMLDTAPNAFDDQYEGCVNKMEEKAPLLLQEDFNMNAKLKVAWEEAKKRWNNIKPSRSYPKGFNDFHGTALVAYTGSIAVDFNRAVREFKENPGQFHYKAFHYYLTRALQLLSNGDCHSVYRGTKTRFHYTGAGSVRFGQFTSSSLSKKVAQSQEFFSDHGTLFIIKTCLGVYIKEFSFRPDQEEVLIPGYEVYQKVRTQGYNEIFLDSPKRKKSNYNCLYSSAGARESCVSLFLVVLPSLLVQLLCLAEP
Tissue specificity:Postthymic T-cells.
Induction:
Developmental stage:
Protein families: