MK12_RAT Q63538
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q63538
Recommended name：Mitogen-activated protein kinase 12
EC number：EC:2.7.11.24
Alternative names：MAP kinase 12; MAPK 12
Cleaved into：
GeneID：60352
Gene names (primary )：Mapk12
Gene names (synonym )：Sapk3
Gene names (ORF )：
Length：367
Mass：41,985
Sequence：MSSPPPARKGFYRQEVTKTAWEVRAVYQDLQPVGSGAYGAVCSAVDSRTGNKVAIKKLYRPFQSELFAKRAYRELRLLKHMRHENVIGLLDVFTPDETLDDFTDFYLVMPFMGTDLGKLMKHETLSEDRIQFLVYQMLKGLKYIHAAGVIHRDLKPGNLAVNEDCELKILDFGLARQADSEMTGYVVTRWYRAPEVILNWMRYTQTVDIWSVGCIMAEMITGKILFKGNDHLDQLKEIMKVTGTPPPEFVQKLQSAEAKNYMEGLPELEKKDFASVLTNASPQAVNLLEKMLVLDAEQRVTAAEALAHPYFESLRDTEDEPKAQKYDDSFDDVDRTLEEWKRVTYKEVLSFKPPRQLGARVPKETAL
Tissue specificity：Highly expressed in skeletal muscle, lung and testes and also in the heart and thymus of both adult and neonatal rats. 1
Induction：
Developmental stage：
Protein families：protein kinase superfamily