KCNJ9_RAT Q63511
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q63511
Recommended name:G protein-activated inward rectifier potassium channel 3
EC number:
Alternative names:Inward rectifier K(+) channel Kir3.3 Potassium channel, inwardly rectifying subfamily J member 9
Cleaved into:
GeneID:116560
Gene names (primary ):Kcnj9
Gene names (synonym ):Girk3
Gene names (ORF ):
Length:393
Mass:43,965
Sequence:MAQENAAFSPGSEEPPRRRGRQRYVEKDGRCNVQQGNVRETYRYLTDLFTTLVDLQWRLSLLFFVLAYALTWLFFGAIWWLIAYGRGDLEHLEDTAWTPCVNNLNGFVAAFLFSIETETTIGYGHRVITDQCPEGIVLLLLQAILGSMVNAFMVGCMFVKISQPNKRAATLVFSSHAVVSLRDGRLCLMFRVGDLRSSHIVEASIRAKLIRSRQTLEGEFIPLHQTDLSVGFDTGDDRLFLVSPLVISHEIDAASPFWEASRRALERDDFEIVVILEGMVEATGMTCQARSSYLVDEVLWGHRFTSVLTLEDGFYEVDYASFHETFEVPTPSCSARELAEAAARLDAHLYWSIPSRLDEKVEEEGAGEGAGAGDGADKEQNGCLPPPESESKV
Tissue specificity:
Induction:
Developmental stage:
Protein families:inward rectifier-type potassium channel (TC 1.A.2.1) family