PDK1_RAT Q63065
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q63065
Recommended name：[Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrial
EC number：EC:2.7.11.2
Alternative names：PDK p48 Pyruvate dehydrogenase kinase isoform 1 (PDH kinase 1)
Cleaved into：
GeneID：
Gene names (primary )：Pdk1
Gene names (synonym )：Pdh
Gene names (ORF )：
Length：434
Mass：49,081
Sequence：MRLARLLRGGTSVRPLCAVPCASRSLASDSASGSGPASESGVPGQVDFYARFSPSPLSMKQFLDFGSVNACEKTSFMFLRQELPVRLANIMKEISLLPDNLLRTPSVQLVQSWYIQSLQELLDFKDKSAEDAKTIYEFTDTVIRIRNRHNDVIPTMAQGVTEYKESFGVDPVTSQNVQYFLDRFYMSRISIRMLLNQHSLLFGGKGSPSHRKHIGSINPNCDVVEVIKDGYENARRLCDLYYVNSPELELEELNAKSPGQPIQVVYVPSHLYHMVFELFKNAMRATMEHHADKGVYPPIQVHVTLGEEDLTVKMSDRGGGVPLRKIDRLFNYMYSTAPRPRVETSRAVPLAGFGYGLPISRLYAQYFQGDLKLYSLEGYGTDAVIYIKALSTESIERLPVYNKAAWKHYRTNHEADDWCVPSREPKDMTTFRSS
Tissue specificity：Detected in pancreas islets (at protein level). Expressed predominantly in the heart. 3 s
Induction：
Developmental stage：Up-regulated via the HIF1A signaling pathway in response to hypoxia. Down-regulated in response to prolonged fasting. 2 s
Protein families：