MARH2_RAT   Q5I0I2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q5I0I2

Recommended name:E3 ubiquitin-protein ligase MARCHF2

EC number:EC:2.3.2.27

Alternative names:Membrane-associated RING finger protein 2 Membrane-associated RING-CH protein II (MARCH-II) RING finger protein 172 By Similarity (RNF172) RING-type E3 ubiquitin transferase MARCHF2 Curated

Cleaved into:

GeneID:362849

Gene names  (primary ):Marchf2

Gene names  (synonym ):March2, Rnf172

Gene names  (ORF ):

Length:246

Mass:27,169

Sequence:MTTGDCCHLPGSLCDCSSSPAFSKVVEATGLGPPQYVAQVTSRDGRLLSTVIRALDTPSDCPFCRICHEGANGENLLSPCGCTGTLGAVHKSCLEKWLSSSNTSYCELCHTEFAVEKRPRPLTEWLKDPGPRTEKRTLCCDMVCFVFITPLAAISGWLCLRGAQDHLRLHSRLEAVGLIALTIALFTIYVLWTLVSFRYHCQLYSEWRKTNQKVRLKIREADGSEDPHHSLLATGLLKKVAEETPV

Tissue specificity:Ubiquitously expressed. Present in liver (at protein level). 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp