CDK20_RAT   Q4KM34


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q4KM34

Recommended name:Cyclin-dependent kinase 20

EC number:EC:2.7.11.22

Alternative names:Cell cycle-related kinase Cell division protein kinase 20

Cleaved into:

GeneID:364666

Gene names  (primary ):Cdk20

Gene names  (synonym ):Ccrk

Gene names  (ORF ):

Length:346

Mass:38,449

Sequence:MDQYCILGRIGEGAHGIVFKAKHVETGEIVALKKVALRRLEDGIPNQALREIKALQEIEDSQYVVQLKAVFPHGAGFVLAFEFMLSDLAEVVRHAQRPLAPAQVKSYLQMLLKGVAFCHANNIVHRDLKPANLLISASGQLKIADFGLARVFSPDGGRLYTHQVATRWYRAPELLYGARQYDQGVDLWAVGCIMGELLNGSPLFPGENDIEQLCCVLRILGTPSPRVWPEITELPDYNKISFKEQAPVPLEEVLPDASHQALDLLGQFLLYPPRQRIAASQALLHQYFFTAPLPAHPSELPIPQRPGGPTPKAHPGPPHVHDFHVDRPLEESLLNPELIRPFIPEG

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp