INSI1_RAT Q08755
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q08755
Recommended name：Insulin-induced gene 1 protein By Similarity
EC number：
Alternative names：Immediate-early protein CL-6 1 Publication Insulin-induced growth response protein CL-6 1 Publication
Cleaved into：
GeneID：64194
Gene names (primary )：Insig1
Gene names (synonym )：Cl-6 1 Publication
Gene names (ORF )：
Length：259
Mass：28,232
Sequence：MPRLHDHVWSYPSAGAARPYSLPRGMIAAALCPQGPGAPEPEPAPRGQREGTAGFSARPGSWHHDLVQRSLVLFSFGVVLALVLNLLQIQRNVTLFPDEVIATIFSSAWWVPPCCGTAAAVVGLLYPCIDSHLGEPHKFKREWASVMRCIAVFVGINHASAKLDFANNVQLSLTLAALSLGLWWTFDRSRSGLGLGITIAFLATLITQFLVYNGVYQYTSPDFLYIRSWLPCIFFSGGVTVGNIGRQLAMGVPEKPHSD
Tissue specificity：Highly expressed in liver and kidney. 1
Induction：
Developmental stage：By insulin and hepatectomy. 1
Protein families：