H2B1A_RAT Q00729
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q00729
Recommended name：Histone H2B type 1-A
EC number：
Alternative names：
Cleaved into：
GeneID：24829
Gene names (primary )：H2bc1
Gene names (synonym )：Hist1h2ba Imported, Th2b
Gene names (ORF )：
Length：127
Mass：14,225
Sequence：MPEVSAKGTTISKKGFKKAVTKTQKKEGRKRKRCRKESYSIYIYKVLKQVHPDTGISSKAMSIMNSFVTDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
Tissue specificity：Testis. Expressed in pachytene spermatocytes during meiotic prophase I in the absence of any significant DNA synthesis. 1
Induction：
Developmental stage：
Protein families：