H33_RAT P84245
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P84245
Recommended name：Histone H3.3
EC number：
Alternative names：
Cleaved into：
GeneID：117056
Gene names (primary )：H3-3b By Similarity
Gene names (synonym )：H3.3b, H3f3b Imported
Gene names (ORF )：
Length：136
Mass：15,328
Sequence：MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Tissue specificity：Expressed throughout the cell cycle independently of DNA synthesis. Levels increase from embryonic day 18 to postnatal day 10. 1
Induction：
Developmental stage：
Protein families：histone H3 family