HINT1_RAT P62959
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P62959
Recommended name：Adenosine 5'-monophosphoramidase HINT1 By Similarity
EC number：EC:3.9.1.-
Alternative names：17 kDa inhibitor of protein kinase C Desumoylating isopeptidase HINT1 By Similarity (EC:3.4.22.- By Similarity) . EC:3.4.22.- (UniProtKB | ENZYME | Rhea) By Similarity Histidine triad nucleotide-binding protein 1 Protein kinase C inhibitor 1 Protein kinase C-interacting protein 1 (PKCI-1)
Cleaved into：
GeneID：690660
Gene names (primary )：Hint1
Gene names (synonym )：Hint, Pkci1
Gene names (ORF )：
Length：126
Mass：13,777
Sequence：MADEIAKAQVAQPGGDTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKHISQISVADDDDESLLGHLMIVGKKCAADLGLKRGYRMVVNEGADGGQSVYHIHLHVLGGRQMNWPPG
Tissue specificity：
Induction：
Developmental stage：
Protein families：