SNX16_RAT P57769
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P57769
Recommended name:Sorting nexin-16
EC number:
Alternative names:
Cleaved into:
GeneID:64088
Gene names (primary ):Snx16
Gene names (synonym ):
Gene names (ORF ):
Length:344
Mass:38,848
Sequence:MATPYVPVPMPIGNSASSFTNNRNQRSSSFGSVSTSSNSSKGQLEDSSVGTCKHTNVQDQMDSASSVCGSPLIRTKFTGTDSSIEYSARPRDTEEQHPDALNWEDRPSTPTILGYEVMEERAKFTVYKILVKKSPEESWVVFRRYTDFSRLNDKLKEMFPGFRLALPPKRWFKDNYNADFLEDRQLGLQAFLQNLVAHKDIANCLAVREFLCLDDPPGPFDSLEESRAFCETLEETNYHLQRELLEKQKEVESLKKLLGEKQLHIDALETRIRTLSLEPGASLYVSRAEGGQILRVQSSVLQVNRDVLDEESRADHKPHFNSREAGSAIADIEVAQLAYNAEDD
Tissue specificity:
Induction:
Developmental stage:
Protein families:sorting nexin family