CP2CN_RAT P24470
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P24470
Recommended name：Cytochrome P450 2C23
EC number：EC:1.14.14.-
Alternative names：Arachidonic acid epoxygenase CYPIIC23
Cleaved into：
GeneID：
Gene names (primary )：Cyp2c23 1 Publication
Gene names (synonym )：Cyp2c-23
Gene names (ORF )：
Length：494
Mass：56,433
Sequence：MELLGFTTLALVVSVTCLSLLSVWTKLRTRGRLPPGPTPLPIIGNLLQLNLKDIPASLSKLAKEYGPVYTLYFGTSPTVVLHGYDVVKEALLQQGDEFLGRGPLPIIEDTHKGYGLIFSNGERWKVMRRFSLMTLRNFGMGKRSLEERVQEEARCLVEELQKTKAQPFDPTFILACAPCNVICSILFNDRFQYNDKTFLNLMDLLNKNFQQVNSVWCQMYNLWPTIIKYLPGKHIEFAKRIDDVKNFILEKVKEHQKSLDPANPRDYIDCFLSKIEEEKDNLKSEFHLENLAVCGSNLFTAGTETTSTTLRFGLLLLMKYPEVQAKVHEELDRVIGRHQPPSMKDKMKLPYTDAVLHEIQRYITLLPSSLPHAVVQDTKFRDYVIPKGTTVLPMLSSVMLDQKEFANPEKFDPGHFLDKNGCFKKTDYFVPFSLGKRACVGESLARMELFLFFTTLLQKFSLKTLVEPKDLDIKPITTGIINLPPPYKLCLVPR
Tissue specificity：Expressed in kidney and liver. Expressed in cortical tubules of kidney (at protein level). 3 s
Induction：
Developmental stage：Constitutively expressed. Up-regulated by fenofibrate. 1
Protein families：