MPPD2_RAT   B1WBP0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:B1WBP0

Recommended name:Metallophosphoesterase MPPED2

EC number:

Alternative names:239FB 1 Publication Fetal brain protein 239 homolog Metallophosphoesterase domain-containing protein 2

Cleaved into:

GeneID:362185

Gene names  (primary ):Mpped2

Gene names  (synonym ):

Gene names  (ORF ):

Length:294

Mass:33,336

Sequence:MAHGIPSQGKVTITVDEYSSNPTQAFTHYNINQSRFQPPHVHMVDPIPYDTPKPAGHTRFVCISDTHSRTDGIQMPYGDILLHTGDFTELGLPSEVKKFNDWLGNLPYEYKIVIAGNHELTFDKEFMADLVKQDYYRFPSVSKLKPEDFDNVQSLLTNSIYLQDSEVTVKGFRIYGAPWTPWFNGWGFNLPRGQSLLDKWNLIPEGTDILMTHGPPLGFRDWVPKELQRVGCVELLNTVQRRVRPKLHVFGGIHEGYGTMTDGYTTYINASTCTVSFQPTNPPIIFDLPNPQGS

Tissue specificity:Expressed in fetal brain (at protein level). detected in fetal and adult brain. 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp