ELOV5_RAT Q920L7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q920L7
Recommended name：Very long chain fatty acid elongase 5 UniRule Annotation
EC number：EC:2.3.1.199
Alternative names：3-keto acyl-CoA synthase Elovl5 UniRule Annotation ELOVL fatty acid elongase 5 UniRule Annotation (ELOVL FA elongase 5 UniRule Annotation) Elongation of very long chain fatty acids protein 5 UniRule Annotation Fatty acid elongase 1 (rELO1) Very long chain 3-ketoacyl-CoA synthase 5 UniRule Annotation Very long chain 3-oxoacyl-CoA synthase 5 UniRule Annotation
Cleaved into：
GeneID：171400
Gene names (primary )：Elovl5 UniRule Annotation
Gene names (synonym )：
Gene names (ORF )：
Length：299
Mass：35,235
Sequence：MEHFDASLSTYFRALLGPRDTRVKGWFLLDNYIPTFVCSAIYLLIVWLGPKYMKNRQPFSCRGILVVYNLGLTLLSLYMFYELVTGVWEGKYNFFCQGTRSAGESDMKVIRVLWWYYFSKLIEFMDTFFFILRKNNHQITVLHVYHHATMLNIWWFVMNWVPCGHSYFGATLNSFIHVLMYSYYGLSSVPSMRPYLWWKKYITQGQLVQFVLTIIQTSCGVIWPCSFPLGWLYFQIGYMISLIALFTNFYIQTYNKKGASRRKEHLKGHQNGSMTAVNGHTNNFASLENSVTSRKQRKD
Tissue specificity：Highly expressed in lung and brain. 1
Induction：
Developmental stage：
Protein families：