PPID_RAT   Q6DGG0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q6DGG0

Recommended name:Peptidyl-prolyl cis-trans isomerase D By Similarity

EC number:EC:5.2.1.8

Alternative names:PPIase D By Similarity

Cleaved into:

GeneID:361967

Gene names  (primary ):Ppid

Gene names  (synonym ):

Gene names  (ORF ):

Length:370

Mass:40,766

Sequence:MSHPSPAGKPSNSKNPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGTGPTTGKPLHFKGCPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSMANAGPNTNGSQFFITTVPTPHLDGKHVVFGQVIKGLGVARMLENVEVNGEKPAKLCVIAECGELKEGDEWGIFPKDGSGDSHPDFPEDADIDLKDVDKILLISEDLKNIGNTFFKSQNWEMAIKKYAKVLRYLDSSKAVIEKADVSRLQPIALSCVLNIGACKLKMSNWQGAIDSCLEALEMDPSNTKALYRKAQGWQGLKEYDQALADLKKAQEIAPGDKAIQAELLKVKQMIKAQKDKEKAVYAKMFA

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp