CLYBL_RAT Q5I0K3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q5I0K3
Recommended name:Citramalyl-CoA lyase, mitochondrial By Similarity
EC number:EC:4.1.3.25
Alternative names:(3S)-malyl-CoA thioesterase By Similarity (EC:3.1.2.30 By Similarity) . EC:3.1.2.30 (UniProtKB | ENZYME | Rhea) By Similarity Beta-methylmalate synthase (EC:2.3.3.- By Similarity) . EC:2.3.3.- (UniProtKB | ENZYME | Rhea) By Similarity Citrate lyase subunit beta-like protein, mitochondrial (Citrate lyase beta-like) Malate synthase (EC:2.3.3.9 By Similarity) . EC:2.3.3.9 (UniProtKB | ENZYME | Rhea) By Similarity
Cleaved into:
GeneID:
Gene names (primary ):Clybl
Gene names (synonym ):
Gene names (ORF ):
Length:338
Mass:37,321
Sequence:MALCVLQNAVRGAAALPRLKASLVASVCRPGYSSLSNHKYVPRRAVLYVPGNDEKKIRKIPSLKVDCAVLDCEDGVAENKKNEARLRIAKTLEDFDLGTTEKCVRINSVSSGLAEADLETFLQARVLPSSLMLPKVEGPEEIQWFSDKFSLHLKGRKLEQPMNLIPFVETAMGLLNFKAVCEETLKIGPQVGLFLDAVVFGGEDFRASIGATSNKDTQDILYARQKIVVTAKAFGLQAIDLVYIDFRDEDGLLRQSREAAAMGFTGKQVIHPNQIAVVQEQFTPTPEKIRWAEELIAAFKEHQQLGKGAFTFQGSMIDMPLLKQAQNIVTLATSIKEK
Tissue specificity:
Induction:
Developmental stage:
Protein families: