NEUG_RAT Q04940
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q04940
Recommended name：Neurogranin
EC number：
Alternative names：Protein kinase C substrate 7.5 kDa protein RC3
Cleaved into：
GeneID：64356
Gene names (primary )：Nrgn
Gene names (synonym )：
Gene names (ORF )：
Length：78
Mass：7,496
Sequence：MDCCTESACSKPDDDILDIPLDDPGANAAAAKIQASFRGHMARKKIKSGECGRKGPGPGGPGGAGGARGGAGGGPSGD
Tissue specificity：Highly enriched in brain with restricted expression in neuronal subsets primarily in the cortex, striatum, and hippocampus as well as certain nuclei within the thalamus, hypothalamus and olfactory bulb. Accumulates postsynaptically in dendritic spines of neostriatal neurons. 2 s
Induction：
Developmental stage：
Protein families：neurogranin family