DHI2_RAT   P50233


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P50233

Recommended name:11-beta-hydroxysteroid dehydrogenase type 2

EC number:EC:1.1.1.-

Alternative names:11-DH2; 11-beta-HSD2

Cleaved into:

GeneID:25117

Gene names  (primary ):Hsd11b2

Gene names  (synonym ):Hsd11k

Gene names  (ORF ):

Length:400

Mass:43,726

Sequence:MERWPWPSGGAWLLVAARALLQLLRSDLRLGRPLLAALALLAALDWLCQRLLPPPAALVVLAGAGWIALSRLARPPRLPVATRAVLITGCDTGFGKETAKKLDAMGFTVLATVLDLNGPGALELRARCSPRLKLLQMDLTKPEDISRVLEITKAHTASTGLWGLVNNAGLNMVVADVELSPVVTFRECMEVNFFGALELTKGLLPLLRHSRGRIVTVGSPAGDMPYPCLAAYGTSKAAIALLMDTFSCELLPWGIKVSIIQPGCFKTEAVTNVNLWEKRKQLLLANLPRELLQAYGEDYIEHLHGQFLNSLRMALPDLSPVVDAIIDALLAAQPRSRYYTGRGLGLMYFIHHYLPGGLRRRFLQNFFISHLLPRALRPGQPGPVHDTTQDPNPSPTVSAL

Tissue specificity:Highly expressed in kidney, adrenal gland and distal colon, and at much lower levels in lung, hypothalamus, hippocampus, and midbrain. 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp