GLNA_RAT P09606
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P09606
Recommended name：Glutamine synthetase 1 Publication
EC number：EC:6.3.1.2
Alternative names：GS 1 Publication
Cleaved into：
GeneID：24957
Gene names (primary )：Glul
Gene names (synonym )：Glns
Gene names (ORF )：
Length：373
Mass：42,268
Sequence：MATSASSHLNKGIKQMYMNLPQGEKIQLMYIWVDGTGEGLRCKTRTLDCDPKCVEELPEWNFDGSSTFQSEGSNSDMYLHPVAMFRDPFRRDPNKLVFCEVFKYNRKPAETNLRHSCKRIMDMVSSQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADKAYGRDIVEAHYRACLYAGIKITGTNAEVMPAQWEFQIGPCEGIRMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLRCIEEAIDKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRIVGQEKKGYFEDRRPSANCDPYAVTEAIVRTCLLNETGDEPFQYKN
Tissue specificity：In the adult liver, expression is restricted to a small population of hepatocytes which form only a small rim of one to three hepatocytes around the central veins (PubMed:6138251). Expressed in lung microvascular endothelial cells (PubMed:7638749). 2 s
Induction：
Developmental stage：By glucocorticoids (PubMed:18555765). Stimulated by the N-methyl-D-aspartate (NMDA) type glutamate receptor antagonist MK801 (PubMed:18555765). Vitamin D and the Wnt signaling pathway inhibit its expression and activity (PubMed:18555765). Down-regulated during osteoblast mineralization (PubMed:18555765). 1
Protein families：