YI001_HUMAN   Q96NJ1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q96NJ1

Recommended name:Uncharacterized protein FLJ30774

EC number:

Alternative names:

Cleaved into:

GeneID:158055

Gene names  (primary ):

Gene names  (synonym ):

Gene names  (ORF ):

Length:140

Mass:14269

Sequence:MRRERPELRDAEGRLRLRAGCLVTAWPRAPSGAGSWSMAAASPWPASWGFPDASSTVPSLCTEARAGRGGPATARSRVSADSQGGRAGSSSPSSALRLCCAGPSQAHPGPSPAVLPGRCGLLGSFPRPPAPQGRWGPSLG

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp