C10_HUMAN   Q99622


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q99622

Recommended name:Protein C10

EC number:

Alternative names:

Cleaved into:

GeneID:113246

Gene names  (primary ):C12orf57

Gene names  (synonym ):C10

Gene names  (ORF ):

Length:126

Mass:13178

Sequence:MASASTQPAALSAEQAKVVLAEVIQAFSAPENAVRMDEARDNACNDMGKMLQFVLPVATQIQQEVIKAYGFSCDGEGVLKFARLVKSYEAQDPEIASLSGKLKALFLPPMTLPPHGPAAGGSVAAS

Tissue specificity:Ubiquitously expressed, with higher expression in lung and fetal brain. {ECO:0000269|PubMed:23453666}.

Induction:

Developmental stage:

Protein families:UPF0456 family


   💬 WhatsApp