LYZL6_HUMAN   O75951


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O75951

Recommended name:Lysozyme-like protein 6

EC number:EC:3.2.1.17

Alternative names:

Cleaved into:

GeneID:57151

Gene names  (primary ):LYZL6

Gene names  (synonym ):LYC1

Gene names  (ORF ):UNQ754/PRO1485

Length:148

Mass:16956

Sequence:MTKALLIYLVSSFLALNQASLISRCDLAQVLQLEDLDGFEGYSLSDWLCLAFVESKFNISKINENADGSFDYGLFQINSHYWCNDYKSYSENLCHVDCQDLLNPNLLAGIHCAKRIVSGARGMNNWVEWRLHCSGRPLFYWLTGCRLR

Tissue specificity:Expressed in testis, epididymis and spermatozoa (at protein level) (PubMed:16014814, PubMed:28182716). Expressed in late-stage spermatocytes and round spermatids (PubMed:28182716). {ECO:0000269|PubMed:16014814, ECO:0000269|PubMed:28182716}.

Induction:

Developmental stage:

Protein families:Glycosyl hydrolase 22 family


   💬 WhatsApp