YAE1_HUMAN   Q9NRH1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9NRH1

Recommended name:Protein YAE1 homolog

EC number:

Alternative names:(Yae1 domain-containing protein 1)

Cleaved into:

GeneID:57002

Gene names  (primary ):YAE1

Gene names  (synonym ):C7orf36 YAE1D1

Gene names  (ORF ):GK003

Length:226

Mass:25299

Sequence:MSWVQAASLIQGPGDKGDVFDEEADESLLAQREWQSNMQRRVKEGYRDGIDAGKAVTLQQGFNQGYKKGAEVILNYGRLRGTLSALLSWCHLHNNNSTLINKINNLLDAVGQCEEYVLKHLKSITPPSHVVDLLDSIEDMDLCHVVPAEKKIDEAKDERLCENNAEFNKNCSKSHSGIDCSYVECCRTQEHAHSENPSPTWILEQTASLVKQLGLSVDVLQHLKQL

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp