KCNG3_HUMAN Q8TAE7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8TAE7
Recommended name:Potassium voltage-gated channel subfamily G member 3
EC number:
Alternative names:(Voltage-gated potassium channel subunit Kv10.1) (Voltage-gated potassium channel subunit Kv6.3)
Cleaved into:
GeneID:170850
Gene names (primary ):KCNG3
Gene names (synonym ):
Gene names (ORF ):
Length:436
Mass:49593
Sequence:MTFGRSGAASVVLNVGGARYSLSRELLKDFPLRRVSRLHGCRSERDVLEVCDDYDRERNEYFFDRHSEAFGFILLYVRGHGKLRFAPRMCELSFYNEMIYWGLEGAHLEYCCQRRLDDRMSDTYTFYSADEPGVLGRDEARPGGAEAAPSRRWLERMRRTFEEPTSSLAAQILASVSVVFVIVSMVVLCASTLPDWRNAAADNRSLDDRSRYSAGPGREPSGIIEAICIGWFTAECIVRFIVSKNKCEFVKRPLNIIDLLAITPYYISVLMTVFTGENSQLQRAGVTLRVLRMMRIFWVIKLARHFIGLQTLGLTLKRCYREMVMLLVFICVAMAIFSALSQLLEHGLDLETSNKDFTSIPAACWWVIISMTTVGYGDMYPITVPGRILGGVCVVSGIVLLALPITFIYHSFVQCYHELKFRSARYSRSLSTEFLN
Tissue specificity:Expressed in the brain, liver, testis, small intestine, colon, thymus and adrenal gland (PubMed:11852086, PubMed:12060745). {ECO:0000269|PubMed:11852086, ECO:0000269|PubMed:12060745}.
Induction:
Developmental stage:
Protein families:Potassium channel family, G (TC 1.A.1.2) subfamily, Kv6.3/KCNG3 sub-subfamily