VENTX_HUMAN   O95231


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O95231

Recommended name:Homeobox protein VENTX

EC number:

Alternative names:(VENT homeobox homolog) (VENT-like homeobox protein 2)

Cleaved into:

GeneID:27287

Gene names  (primary ):VENTX

Gene names  (synonym ):HPX42B VENTX2

Gene names  (ORF ):

Length:258

Mass:27552

Sequence:MRLSSSPPRGPQQLSSFGSVDWLSQSSCSGPTHTPRPADFSLGSLPGPGQTSGAREPPQAVSIKEAAGSSNLPAPERTMAGLSKEPNTLRAPRVRTAFTMEQVRTLEGVFQHHQYLSPLERKRLAREMQLSEVQIKTWFQNRRMKHKRQMQDPQLHSPFSGSLHAPPAFYSTSSGLANGLQLLCPWAPLSGPQALMLPPGSFWGLCQVAQEALASAGASCCGQPLASHPPTPGRPSLGPALSTGPRGLCAMPQTGDAF

Tissue specificity:Expressed in bone marrow of patients recovering from chemotherapy. Also expressed in an erythroleukemia cell line. {ECO:0000269|PubMed:11549314}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp