VATO_HUMAN   Q99437


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q99437

Recommended name:V-type proton ATPase 21 kDa proteolipid subunit

EC number:

Alternative names:(V-ATPase 21 kDa proteolipid subunit) (Vacuolar proton pump 21 kDa proteolipid subunit) (hATPL)

Cleaved into:

GeneID:533

Gene names  (primary ):ATP6V0B

Gene names  (synonym ):ATP6F

Gene names  (ORF ):

Length:205

Mass:21406

Sequence:MTGLALLYSGVFVAFWACALAVGVCYTIFDLGFRFDVAWFLTETSPFMWSNLGIGLAISLSVVGAAWGIYITGSSIIGGGVKAPRIKTKNLVSIIFCEAVAIYGIIMAIVISNMAEPFSATDPKAIGHRNYHAGYSMFGAGLTVGLSNLFCGVCVGIVGSGAALADAQNPSLFVKILIVEIFGSAIGLFGVIVAILQTSRVKMGD

Tissue specificity:Ubiquitous.

Induction:

Developmental stage:

Protein families:V-ATPase proteolipid subunit family


   💬 WhatsApp