TNMD_HUMAN   Q9H2S6


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9H2S6

Recommended name:Tenomodulin

EC number:

Alternative names:(TeM) (hTeM) (Chondromodulin-1-like protein) (ChM1L) (hChM1L) (Chondromodulin-I-like protein) (Myodulin) (Tendin)

Cleaved into:

GeneID:64102

Gene names  (primary ):TNMD

Gene names  (synonym ):CHM1L

Gene names  (ORF ):UNQ771/PRO1565

Length:317

Mass:37130

Sequence:MAKNPPENCEDCHILNAEAFKSKKICKSLKICGLVFGILALTLIVLFWGSKHFWPEVPKKAYDMEHTFYSNGEKKKIYMEIDPVTRTEIFRSGNGTDETLEVHDFKNGYTGIYFVGLQKCFIKTQIKVIPEFSEPEEEIDENEEITTTFFEQSVIWVPAEKPIENRDFLKNSKILEICDNVTMYWINPTLISVSELQDFEEEGEDLHFPANEKKGIEQNEQWVVPQVKVEKTRHARQASEEELPINDYTENGIEFDPMLDERGYCCIYCRRGNRYCRRVCEPLLGYYPYPYCYQGGRVICRVIMPCNWWVARMLGRV

Tissue specificity:Highly expressed in hypovascular connective tissues such as tendons. Has also strong expression in adipose tissue. {ECO:0000269|PubMed:19602561, ECO:0000269|PubMed:19780194, ECO:0000269|PubMed:22700804}.

Induction:

Developmental stage:

Protein families:Chondromodulin-1 family


   💬 WhatsApp