TCAL1_HUMAN Q15170
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q15170
Recommended name：Transcription elongation factor A protein-like 1
EC number：
Alternative names：(TCEA-like protein 1) (Nuclear phosphoprotein p21/SIIR) (Transcription elongation factor S-II protein-like 1)
Cleaved into：
GeneID：9338
Gene names (primary )：TCEAL1
Gene names (synonym )：SIIR
Gene names (ORF )：
Length：157
Mass：18354
Sequence：MDKPRKENEEEPQSRPRPMRRGLRWSTLPKSSPPRSSLRRSSPRRRSSFLRSSCLSSCLRCSSRRTPSAGLSRKDLFEGRPPMEQPPCGVGKHKLEEGSFKERLARSRPQFRGDIHGRNLSNEEMIQAADELEEMKRVRNKLMIMHWKAKRSRPYPI
Tissue specificity：Expressed in all tissues examined. Highly expressed in heart, ovary, prostate and skeletal muscle. Moderately expressed in brain, placenta, testis and small intestine. Weakly expressed in lung, liver and spleen. Expressed in several cancer cell lines. {ECO:0000269|PubMed:10051408}.
Induction：
Developmental stage：
Protein families：TFS-II family, TFA subfamily