ST1C3_HUMAN   Q6IMI6


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q6IMI6

Recommended name:Sulfotransferase 1C3

EC number:EC:2.8.2.1

Alternative names:(ST1C3)

Cleaved into:

GeneID:442038

Gene names  (primary ):SULT1C3

Gene names  (synonym ):

Gene names  (ORF ):

Length:304

Mass:35889

Sequence:MAKIEKNAPTMEKKPELFNIMEVDGVPTLILSKEWWEKVCNFQAKPDDLILATYPKSGTTWMHEILDMILNDGDVEKCKRAQTLDRHAFLELKFPHKEKPDLEFVLEMSSPQLIKTHLPSHLIPPSIWKENCKIVYVARNPKDCLVSYYHFHRMASFMPDPQNLEEFYEKFMSGKVVGGSWFDHVKGWWAAKDMHRILYLFYEDIKKDPKREIEKILKFLEKDISEEILNKIIYHTSFDVMKQNPMTNYTTLPTSIMDHSISPFMRKGMPGDWKNYFTVAQNEEFDKDYQKKMAGSTLTFRTEI

Tissue specificity:[Isoform 1]: Not detectable in any of the tissues tested. {ECO:0000269|PubMed:14676822}.; [Isoform 2]: Expressed in the small intestine. {ECO:0000269|PubMed:24335392}.

Induction:

Developmental stage:

Protein families:Sulfotransferase 1 family


   💬 WhatsApp