SAMD5_HUMAN   Q5TGI4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q5TGI4

Recommended name:Sterile alpha motif domain-containing protein 5

EC number:

Alternative names:(SAM domain-containing protein 5)

Cleaved into:

GeneID:389432

Gene names  (primary ):SAMD5

Gene names  (synonym ):SAMDC1

Gene names  (ORF ):

Length:173

Mass:19231

Sequence:MCTNIVYEWLKALQLPQYAESFVDNGYDDLEVCKQIGDPDLDAIGVLAPAHRRRILEAVRRLREQDANAAGLYFTLEPQPAPPGPPADAVPTGRRGEPCGGPAQGTRGDSRGHTTAPRSRELVSYPKLKLKIMIRDKLVRDGIHLSKPPYSRKVPMAGILEYLMNWPKSSQSR

Tissue specificity:Detected in biliary epithelial cells on bile ducts at the hepatic hilum (at protein level). {ECO:0000269|PubMed:28388653}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp