S10AE_HUMAN   Q9HCY8


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9HCY8

Recommended name:Protein S100-A14

EC number:

Alternative names:(S100 calcium-binding protein A14) (S114)

Cleaved into:

GeneID:57402

Gene names  (primary ):S100A14

Gene names  (synonym ):S100A15

Gene names  (ORF ):

Length:104

Mass:11662

Sequence:MGQCRSANAEDAQEFSDVERAIETLIKNFHQYSVEGGKETLTPSELRDLVTQQLPHLMPSNCGLEEKIANLGSCNDSKLEFRSFWELIGEAAKSVKLERPVRGH

Tissue specificity:Expressed at highest levels in colon and at moderate levels in thymus, kidney, liver, small intestine, and lung. Low expression in heart and no expression is seen in brain, skeletal muscle, spleen, placenta and peripheral blood leukocytes. {ECO:0000269|PubMed:11944983}.

Induction:

Developmental stage:

Protein families:S-100 family


   💬 WhatsApp