RPC8_HUMAN Q9Y535
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9Y535
Recommended name：DNA-directed RNA polymerase III subunit RPC8
EC number：
Alternative names：(RNA polymerase III subunit C8) (DNA-directed RNA polymerase III subunit H) (RNA polymerase III subunit 22.9 kDa subunit) (RPC22.9)
Cleaved into：
GeneID：171568
Gene names (primary )：POLR3H
Gene names (synonym )：KIAA1665 RPC8
Gene names (ORF )：
Length：204
Mass：22918
Sequence：MFVLVEMVDTVRIPPWQFERKLNDSIAEELNKKLANKVVYNVGLCICLFDITKLEDAYVFPGDGASHTKVHFRCVVFHPFLDEILIGKIKGCSPEGVHVSLGFFDDILIPPESLQQPAKFDEAEQVWVWEYETEEGAHDLYMDTGEEIRFRVVDESFVDTSPTGPSSADATTSSEELPKKEAPYTLVGSISEPGLGLLSWWTSN
Tissue specificity：
Induction：
Developmental stage：
Protein families：Eukaryotic RPB7/RPC8 RNA polymerase subunit family